PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G231100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 1632aa    MW: 176795 Da    PI: 7.1214
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G231100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.31.8e-08756798347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT eE e + +  + +G++ +++I++ +  ++t  +c+++++k+
  Brast08G231100.1.p 756 PWTHEEKEVFMQMLATFGKN-FSKISNFLH-HKTTADCVEFYYKH 798
                         8*****************99.*********.************97 PP

2Myb_DNA-binding22.52.7e-079671007345
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                           WT +E  ++v+a +++G++ +++I++++   ++ +qck ++ 
  Brast08G231100.1.p  967 DWTDDERSIFVEAMNMYGKD-FARISSRVK-SKSYEQCKVFFS 1007
                          6*****************99.********9.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-15739801IPR009057Homeodomain-like
PROSITE profilePS5129314.297752803IPR017884SANT domain
SMARTSM007173.6E-8753801IPR001005SANT/Myb domain
PfamPF002493.8E-6755798IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-7755800IPR009057Homeodomain-like
PROSITE profilePS5129313.99631014IPR017884SANT domain
SMARTSM007172.1E-69641012IPR001005SANT/Myb domain
PfamPF002494.7E-69671007IPR001005SANT/Myb domain
SuperFamilySSF466893.28E-99671012IPR009057Homeodomain-like
CDDcd001672.02E-59681006No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1632 aa     Download sequence    Send to blast
MPPPPPDRRD FLYRDGRRHD GGAGGDPLPL PAPAPPRWRD SPYHPPPPPP LRDHARPSPR  60
RTTSSVSSEA YYRQGGGAYE RSYPDEPLGY TPSRSDRYWL EEEAAGYKGF SRYGGGGGRR  120
EGRDMRGSYR RSPFRSYGGD FPRGHQEPPP PPLRRSPLRS VAVPISYDPP GDKADREDRE  180
HHPRVTPWRP LRRRETRSEA ADAAGAGPTS ARQNTGEGTA AEKKAPAQSL AVAAPQTSEE  240
EAPRKKPRLG WGQGLAKYEK QKVHGSADPA EAAAHGSPAD VEQKVDIGTP ASVPCASPVA  300
ASPPAPPSSS PAAEDNKSCE LTTNTATVSN KDIPGAEVQA YNDEIPIKLG QLDGDPIGSL  360
ANVLAELLQH DDSCSGDSRK LTNTSKLLLL KENITKEIEK TELEIDSLEC ELKSANTDIG  420
NRGLEDAQNP SPSSGTSKVP VRPEICDTSS PLKEPGEISP CKISVEQDAD AKGAESMEVD  480
TAPAYSVTAV SSEESVARPV VAETQVSVTA SVAPVKPSQG TGSQIDADSE RQGPSSCHDN  540
VNSVKAGGSN KLSTRPCSHH VDNYNLIPSI IAVNNDIAKE FNELVFKPLP ADQPLSALGP  600
FSIQMKNDLS IKRKLAIHKN RLRFKEQTLT FKFRVLRHLW KEDVRLLSVR KQRPKSNKRT  660
DQSNRASQSG SQRQRSSNRS RLGIPAGNLS TFPTTEISEV ANKMFTEFQF KRCRNYMKMP  720
AVIIDEKEKA CAMFVSKNGL IEDPVSVEKE RAVINPWTHE EKEVFMQMLA TFGKNFSKIS  780
NFLHHKTTAD CVEFYYKHHK SDSFREVKKL LDLRQQQQPT SNYLGTKSGK KWNPVGNAAS  840
LDMLGAASVV AAHDLDYANR VEKNTSKSII RTSYRSDISA VAKGSLDKDC VANVSLHERE  900
SVAADVLAGI CGTLSPEGMG SCITSSADPG QKMGGTRMDY LVTPEVDKSC DEEGTFSDQE  960
CEVYPVDWTD DERSIFVEAM NMYGKDFARI SSRVKSKSYE QCKVFFSKAR ISLGLDMIHP  1020
RNADAGLPTS DTNGGRSDTD EACAAEIDSA ICSAQSSQKM EIDVCPAADG TTQGCHVSGI  1080
TFKQSKTDGS TEPNVGDIKF KEAENKAEDR SCNILVDHKL LSEATPQASQ SCDPIDINSS  1140
ENLQNKVHGN QLTMHGNGAM SSSTEQLVGS QLEIRSNLHD IEVIQSSKAS AGTCTQISSM  1200
EGPSNHAPEI ALMKVGNFTP SVVLSGDCGS KENIVDFQDM AGVSCIRPAF TSSYQQSVPA  1260
DLLQSKPKPQ VTPLTQKDLM PVQFSSDLPD PTSIRFEGIA SITSPNFEDR ASKLINNSGA  1320
KDMNKFTVFG EQSRNQPDAL FRDIDGYMQH RHNHHLPADV PAFSGSPVSC PGGTSHSDQF  1380
TSNKYQNGRS GCSGLSNASA GFLLSRNNAG LQEGQLETCS QKASTESYDQ VKRPGDVKLF  1440
GKILSHQSSL QSSGSSSNGI KSKPPSPKID KSAARLLQSG RDRMVFPSRP ANTAHLGLDE  1500
QSVMSYTHLD GSPVHPDSMF RVANCQRSLA GVPFYSAKNV TLGAFAEYQQ PSKQQLPSDP  1560
KRLESFADLQ KRNGIELISG FQQPGKASRL GGAGILVGAV SDPVAALKAQ YGPGPKILGN  1620
NADPWKDLGN R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C9e-15714805494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D9e-15714805494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231802.10.0PREDICTED: uncharacterized protein LOC100825285
TrEMBLA0A0Q3KAE00.0A0A0Q3KAE0_BRADI; Uncharacterized protein
STRINGBRADI2G38160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-74MYB family protein